SCOP 1.75: Domain d1v9qa1: 1v9q A:0-153

Lineage for d1v9qa1 (1v9q A:0-153)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (180 PDB entries)
   Uniprot P02185

8. Domain d1v9qa1: 1v9q A:0-153 [119893]
   automatically matched to d1j3fa_
   complexed with czm, mn3, po4; mutant

Details for d1v9qa1

PDB Entry: 1v9q, 1.45 Å

PDB Description: crystal structure of an artificial metalloprotein:mn(iii)(3,3'-me2- salophen)/apo-a71g myoglobin

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1v9qa1:

Sequence; same for both SEQRES and ATOM records:

>d1v9qa1 a.1.1.2 (A:0-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1v9qa1:

• d1v9qa1 first appeared in SCOP 1.73
  
• d1v9qa1 is called d1v9qa_ in SCOPe 2.01
  
• d1v9qa1 appears in the current release, SCOPe 2.08, called d1v9qa_