SCOPe 2.07: Domain d1v5ga1: 1v5g A:178-360

Lineage for d1v5ga1 (1v5g A:178-360)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Aerococcus viridans [TaxId:1377] [254914] (2 PDB entries)

8. Domain d1v5ga1: 1v5g A:178-360 [119850]
   Other proteins in same PDB: d1v5ga2, d1v5ga3
   automated match to d1poxa1
   complexed with fad, htl, mg

Details for d1v5ga1

PDB Entry: 1v5g, 1.96 Å

PDB Description: Crystal Structure of the Reaction Intermediate between Pyruvate oxidase containing FAD and TPP, and Substrate Pyruvate

PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d1v5ga1:

Sequence; same for both SEQRES and ATOM records:

>d1v5ga1 c.31.1.0 (A:178-360) automated matches {Aerococcus viridans [TaxId: 1377]}
yssanslrkyapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvi
ttgknfetfewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnf
iqididpamlgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinm
let

Timeline for d1v5ga1:

• d1v5ga1 first appeared in SCOP 1.73
  
• d1v5ga1 appears in SCOPe 2.06
  
• d1v5ga1 appears in the current release, SCOPe 2.08