| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
| Protein automated matches [190312] (14 species) not a true protein |
| Species Aerococcus viridans [TaxId:1377] [254914] (2 PDB entries) |
| Domain d1v5fa1: 1v5f A:178-360 [119847] Other proteins in same PDB: d1v5fa2, d1v5fa3 automated match to d1poxa1 complexed with fad, mg, so4, tpp |
PDB Entry: 1v5f (more details), 1.8 Å
SCOPe Domain Sequences for d1v5fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5fa1 c.31.1.0 (A:178-360) automated matches {Aerococcus viridans [TaxId: 1377]}
yssanslrkyapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvi
ttgknfetfewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnf
iqididpamlgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinm
let
Timeline for d1v5fa1: