Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
Protein Pyruvate oxidase [52476] (2 species) binds FAD |
Species Aerococcus viridans [TaxId:1377] [142122] (4 PDB entries) |
Domain d1v5fa1: 1v5f A:187-363 [119847] Other proteins in same PDB: d1v5fa2, d1v5fa3 automatically matched to 1V5E A:187-363 complexed with fad, mg, so4, tpp |
PDB Entry: 1v5f (more details), 1.8 Å
SCOP Domain Sequences for d1v5fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5fa1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} yapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvittgknfetf ewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnfiqididpam lgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinmletkee
Timeline for d1v5fa1: