Lineage for d1uzka3 (1uzk A:1529-1604)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585857Fold g.23: TB module/8-cys domain [57580] (1 superfamily)
    disulfide-rich; alpha+beta
  4. 2585858Superfamily g.23.1: TB module/8-cys domain [57581] (1 family) (S)
  5. 2585859Family g.23.1.1: TB module/8-cys domain [57582] (2 proteins)
    transforming growth factor beta binding protein-like domain
  6. 2585860Protein Fibrillin [57583] (1 species)
  7. 2585861Species Human (Homo sapiens) [TaxId:9606] [57584] (5 PDB entries)
  8. 2585862Domain d1uzka3: 1uzk A:1529-1604 [119808]
    Other proteins in same PDB: d1uzka1, d1uzka2
    automated match to d1uzpa3
    complexed with ca

Details for d1uzka3

PDB Entry: 1uzk (more details), 1.35 Å

PDB Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, ca bound to cbegf23 domain only
PDB Compounds: (A:) fibrillin-1

SCOPe Domain Sequences for d1uzka3:

Sequence, based on SEQRES records: (download)

>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]}
trsgncyldirprgdngdtacsneigvgvskascccslgkawgtpcemcpavntseykil
cpggegfrpnpitvil

Sequence, based on observed residues (ATOM records): (download)

>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]}
trsgncyldicsneigvgvskascccslgkawgtpcemcpavntseykilcpggegfrpn
pitvil

SCOPe Domain Coordinates for d1uzka3:

Click to download the PDB-style file with coordinates for d1uzka3.
(The format of our PDB-style files is described here.)

Timeline for d1uzka3: