SCOPe 2.08: Domain d1uzhv2: 1uzh V:7-149

Lineage for d1uzhv2 (1uzh V:7-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (6 PDB entries)

8. Domain d1uzhv2: 1uzh V:7-149 [119805]
   Other proteins in same PDB: d1uzha1, d1uzhb1, d1uzhc1, d1uzhe1, d1uzhf_, d1uzhh1, d1uzhi_, d1uzhj_, d1uzhk1, d1uzhm_, d1uzho1, d1uzhp_, d1uzhr1, d1uzht_, d1uzhv1, d1uzhw_
   automated match to d1gk8a2
   complexed with cap, edo, mg

Details for d1uzhv2

PDB Entry: 1uzh, 2.2 Å

PDB Description: a chimeric chlamydomonas, synechococcus rubisco enzyme

PDB Compounds: (V:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uzhv2:

Sequence; same for both SEQRES and ATOM records:

>d1uzhv2 d.58.9.1 (V:7-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
fkalralrledlrippayvktfv

Timeline for d1uzhv2:

• d1uzhv2 first appeared in SCOP 1.73
  
• d1uzhv2 appears in SCOPe 2.07