SCOP 1.75: Domain d1uzho2: 1uzh O:11-149

Lineage for d1uzho2 (1uzh O:11-149)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries)

8. Domain d1uzho2: 1uzh O:11-149 [119801]
   Other proteins in same PDB: d1uzha1, d1uzhb1, d1uzhc1, d1uzhe1, d1uzhf1, d1uzhh1, d1uzhi1, d1uzhj1, d1uzhk1, d1uzhm1, d1uzho1, d1uzhp1, d1uzhr1, d1uzht1, d1uzhv1, d1uzhw1
   automatically matched to d1gk8a2
   complexed with cap, edo, mg

Details for d1uzho2

PDB Entry: 1uzh, 2.2 Å

PDB Description: a chimeric chlamydomonas, synechococcus rubisco enzyme

PDB Compounds: (O:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d1uzho2:

Sequence; same for both SEQRES and ATOM records:

>d1uzho2 d.58.9.1 (O:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

Timeline for d1uzho2:

• d1uzho2 first appeared in SCOP 1.73
  
• d1uzho2 appears in SCOPe 2.01
  
• d1uzho2 appears in the current release, SCOPe 2.08