Lineage for d1uzhe1 (1uzh E:150-475)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1149523Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 1149524Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 1149525Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 1149549Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69403] (11 PDB entries)
  8. 1149628Domain d1uzhe1: 1uzh E:150-475 [119794]
    Other proteins in same PDB: d1uzha2, d1uzhb2, d1uzhc1, d1uzhe2, d1uzhf_, d1uzhh2, d1uzhi_, d1uzhj_, d1uzhk2, d1uzhm_, d1uzho2, d1uzhp_, d1uzhr2, d1uzht_, d1uzhv2, d1uzhw_
    automatically matched to d1gk8a1
    complexed with cap, edo, mg

Details for d1uzhe1

PDB Entry: 1uzh (more details), 2.2 Å

PDB Description: a chimeric chlamydomonas, synechococcus rubisco enzyme
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uzhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzhe1 c.1.14.1 (E:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d1uzhe1:

Click to download the PDB-style file with coordinates for d1uzhe1.
(The format of our PDB-style files is described here.)

Timeline for d1uzhe1: