Lineage for d1uzdh1 (1uzd H:150-475)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1574721Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 1574722Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 1574723Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 1574747Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69403] (4 PDB entries)
  8. 1574779Domain d1uzdh1: 1uzd H:150-475 [119780]
    Other proteins in same PDB: d1uzda2, d1uzdb2, d1uzdc1, d1uzde2, d1uzdf_, d1uzdh2, d1uzdi_, d1uzdj_, d1uzdk2, d1uzdm_, d1uzdo2, d1uzdp_, d1uzdr2, d1uzdt_, d1uzdv2, d1uzdw_
    automated match to d1gk8a1
    complexed with cap, edo, mg

Details for d1uzdh1

PDB Entry: 1uzd (more details), 2.4 Å

PDB Description: chlamydomonas,spinach chimeric rubisco
PDB Compounds: (H:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uzdh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzdh1 c.1.14.1 (H:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d1uzdh1:

Click to download the PDB-style file with coordinates for d1uzdh1.
(The format of our PDB-style files is described here.)

Timeline for d1uzdh1: