Lineage for d1uzde1 (1uzd E:150-475)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685056Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 685057Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 685058Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 685083Species Chlamydomonas reinhardtii [TaxId:3055] [69403] (6 PDB entries)
  8. 685114Domain d1uzde1: 1uzd E:150-475 [119778]
    Other proteins in same PDB: d1uzda2, d1uzdb2, d1uzde2, d1uzdh2, d1uzdk2, d1uzdo2, d1uzdr2, d1uzdv2
    automatically matched to d1gk8a1
    complexed with cap, edo, mg

Details for d1uzde1

PDB Entry: 1uzd (more details), 2.4 Å

PDB Description: chlamydomonas,spinach chimeric rubisco
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d1uzde1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzde1 c.1.14.1 (E:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOP Domain Coordinates for d1uzde1:

Click to download the PDB-style file with coordinates for d1uzde1.
(The format of our PDB-style files is described here.)

Timeline for d1uzde1: