Lineage for d1uywm1 (1uyw M:115-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655405Domain d1uywm1: 1uyw M:115-213 [119773]
    automatically matched to d1igtb2

Details for d1uywm1

PDB Entry: 1uyw (more details), 2 Å

PDB Description: crystal structure of the antiflavivirus fab4g2
PDB Compounds: (M:) fab antibody heavy chain

SCOP Domain Sequences for d1uywm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uywm1 b.1.1.2 (M:115-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1uywm1:

Click to download the PDB-style file with coordinates for d1uywm1.
(The format of our PDB-style files is described here.)

Timeline for d1uywm1: