Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (1 family) |
Family a.104.1.1: Cytochrome P450 [48265] (22 proteins) |
Protein Cytochrome P450-CAM [48266] (1 species) |
Species Pseudomonas putida [TaxId:303] [48267] (60 PDB entries) Uniprot P00183 |
Domain d1uyua1: 1uyu A:11-414 [119770] automatically matched to d1akd__ complexed with cam, hem, k, xe |
PDB Entry: 1uyu (more details), 2 Å
SCOP Domain Sequences for d1uyua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uyua1 a.104.1.1 (A:11-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d1uyua1: