![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
![]() | Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins) |
![]() | Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species) |
![]() | Species Streptococcus sp., group G [TaxId:1306] [54361] (28 PDB entries) |
![]() | Domain d1uwxa1: 1uwx A:5-62 [119765] Other proteins in same PDB: d1uwxh1, d1uwxm1 automatically matched to d1qkza_ |
PDB Entry: 1uwx (more details), 2.2 Å
SCOP Domain Sequences for d1uwxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwxa1 d.15.7.1 (A:5-62) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]} vttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvtek
Timeline for d1uwxa1: