Lineage for d1uwma1 (1uwm A:1-106)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854217Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 854218Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 854219Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 854288Species Rhodobacter capsulatus, ferredoxin VI [TaxId:1061] [64230] (2 PDB entries)
  8. 854290Domain d1uwma1: 1uwm A:1-106 [119763]
    automatically matched to d1e9ma_
    complexed with fes

Details for d1uwma1

PDB Entry: 1uwm (more details), 2 Å

PDB Description: reduced ferredoxin 6 from rhodobacter capsulatus
PDB Compounds: (A:) ferredoxin vi

SCOP Domain Sequences for d1uwma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwma1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]}
akiifiehngtrheveakpgltvmeaardngvpgidadcggacacstchayvdpawvdkl
pkalptetdmidfayepnpatsrltcqikvtslldglvvhlpekqi

SCOP Domain Coordinates for d1uwma1:

Click to download the PDB-style file with coordinates for d1uwma1.
(The format of our PDB-style files is described here.)

Timeline for d1uwma1: