Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein automated matches [190066] (5 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (7 PDB entries) |
Domain d1uwam_: 1uwa M: [119748] Other proteins in same PDB: d1uwaa1, d1uwaa2, d1uwab1, d1uwab2, d1uwae1, d1uwae2, d1uwah1, d1uwah2, d1uwak1, d1uwak2, d1uwao1, d1uwao2, d1uwar1, d1uwar2, d1uwav1, d1uwav2 automated match to d1ir21_ complexed with cap, edo, mg; mutant |
PDB Entry: 1uwa (more details), 2.3 Å
SCOPe Domain Sequences for d1uwam_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwam_ d.73.1.1 (M:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg flvqrpksardwqpankrsv
Timeline for d1uwam_: