Lineage for d1uwaj_ (1uwa J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913207Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1913208Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1913209Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1913367Protein automated matches [190066] (5 species)
    not a true protein
  7. 1913368Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (7 PDB entries)
  8. 1913412Domain d1uwaj_: 1uwa J: [119745]
    Other proteins in same PDB: d1uwaa1, d1uwaa2, d1uwab1, d1uwab2, d1uwae1, d1uwae2, d1uwah1, d1uwah2, d1uwak1, d1uwak2, d1uwao1, d1uwao2, d1uwar1, d1uwar2, d1uwav1, d1uwav2
    automated match to d1ir21_
    complexed with cap, edo, mg; mutant

Details for d1uwaj_

PDB Entry: 1uwa (more details), 2.3 Å

PDB Description: l290f mutant rubisco from chlamydomonas
PDB Compounds: (J:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d1uwaj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwaj_ d.73.1.1 (J:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpksardwqpankrsv

SCOPe Domain Coordinates for d1uwaj_:

Click to download the PDB-style file with coordinates for d1uwaj_.
(The format of our PDB-style files is described here.)

Timeline for d1uwaj_: