SCOPe 2.08: Domain d1uwab2: 1uwa B:11-149

Lineage for d1uwab2 (1uwa B:11-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)

8. Domain d1uwab2: 1uwa B:11-149 [119737]
   Other proteins in same PDB: d1uwaa1, d1uwab1, d1uwac_, d1uwae1, d1uwaf_, d1uwah1, d1uwai_, d1uwaj_, d1uwak1, d1uwam_, d1uwao1, d1uwap_, d1uwar1, d1uwat_, d1uwav1, d1uwaw_
   automated match to d1gk8a2
   complexed with cap, edo, mg; mutant

Details for d1uwab2

PDB Entry: 1uwa, 2.3 Å

PDB Description: l290f mutant rubisco from chlamydomonas

PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uwab2:

Sequence; same for both SEQRES and ATOM records:

>d1uwab2 d.58.9.0 (B:11-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

Timeline for d1uwab2:

• d1uwab2 first appeared in SCOP 1.73
  
• d1uwab2 appears in SCOPe 2.07