Lineage for d1uw9h2 (1uw9 H:11-149)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724752Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 724753Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 724754Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 724779Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (6 PDB entries)
  8. 724819Domain d1uw9h2: 1uw9 H:11-149 [119719]
    Other proteins in same PDB: d1uw9a1, d1uw9b1, d1uw9c1, d1uw9e1, d1uw9f1, d1uw9h1, d1uw9i1, d1uw9j1, d1uw9k1, d1uw9m1, d1uw9o1, d1uw9p1, d1uw9r1, d1uw9t1, d1uw9v1, d1uw9w1
    automatically matched to d1gk8a2
    complexed with cap, edo, mg; mutant

Details for d1uw9h2

PDB Entry: 1uw9 (more details), 2.05 Å

PDB Description: l290f-a222t chlamydomonas rubisco mutant
PDB Compounds: (H:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d1uw9h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw9h2 d.58.9.1 (H:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

SCOP Domain Coordinates for d1uw9h2:

Click to download the PDB-style file with coordinates for d1uw9h2.
(The format of our PDB-style files is described here.)

Timeline for d1uw9h2: