Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries) |
Domain d1uw9b2: 1uw9 B:9-149 [119713] Other proteins in same PDB: d1uw9a1, d1uw9b1, d1uw9c_, d1uw9e1, d1uw9f_, d1uw9h1, d1uw9i_, d1uw9j_, d1uw9k1, d1uw9m_, d1uw9o1, d1uw9p_, d1uw9r1, d1uw9t_, d1uw9v1, d1uw9w_ automated match to d1gk8a2 complexed with cap, edo, mg; mutant |
PDB Entry: 1uw9 (more details), 2.05 Å
SCOPe Domain Sequences for d1uw9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw9b2 d.58.9.0 (B:9-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk alralrledlrippayvktfv
Timeline for d1uw9b2: