Lineage for d1uw9a2 (1uw9 A:11-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953040Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)
  8. 2953073Domain d1uw9a2: 1uw9 A:11-149 [119711]
    Other proteins in same PDB: d1uw9a1, d1uw9b1, d1uw9c_, d1uw9e1, d1uw9f_, d1uw9h1, d1uw9i_, d1uw9j_, d1uw9k1, d1uw9m_, d1uw9o1, d1uw9p_, d1uw9r1, d1uw9t_, d1uw9v1, d1uw9w_
    automated match to d1gk8a2
    complexed with cap, edo, mg; mutant

Details for d1uw9a2

PDB Entry: 1uw9 (more details), 2.05 Å

PDB Description: l290f-a222t chlamydomonas rubisco mutant
PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uw9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw9a2 d.58.9.0 (A:11-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

SCOPe Domain Coordinates for d1uw9a2:

Click to download the PDB-style file with coordinates for d1uw9a2.
(The format of our PDB-style files is described here.)

Timeline for d1uw9a2: