Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:1772] [186784] (1 PDB entry) |
Domain d1uvhd_: 1uvh D: [119709] automated match to d1veia_ complexed with fe |
PDB Entry: 1uvh (more details), 2.8 Å
SCOPe Domain Sequences for d1uvhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvhd_ a.25.1.1 (D:) automated matches {Mycobacterium smegmatis [TaxId: 1772]} tipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgy adevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksi ekledldlvsqdlliahagelekfqwfvrahlesagg
Timeline for d1uvhd_: