![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
![]() | Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (3 species) |
![]() | Species Pseudomonas putida [TaxId:303] [54440] (10 PDB entries) |
![]() | Domain d1uuwb_: 1uuw B: [119704] Other proteins in same PDB: d1uuwa1, d1uuwa2 automated match to d1eg9b_ complexed with fe, fes, no, so4 |
PDB Entry: 1uuw (more details), 2.3 Å
SCOPe Domain Sequences for d1uuwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uuwb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]} miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp erilqthnlmvfl
Timeline for d1uuwb_: