SCOPe 2.08: Domain d1uuva2: 1uuv A:155-447

Lineage for d1uuva2 (1uuv A:155-447)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)

7. Species Pseudomonas putida [TaxId:303] [55971] (10 PDB entries)

8. Domain d1uuva2: 1uuv A:155-447 [119700]
   Other proteins in same PDB: d1uuva1, d1uuvb_
   automated match to d1o7na2
   complexed with edo, fe, fes, ind, no, so4

Details for d1uuva2

PDB Entry: 1uuv, 1.65 Å

PDB Description: naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site.

PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d1uuva2:

Sequence; same for both SEQRES and ATOM records:

>d1uuva2 d.129.3.3 (A:155-447) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida [TaxId: 303]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltktt

Timeline for d1uuva2:

• d1uuva2 first appeared in SCOP 1.73
  
• d1uuva2 appears in SCOPe 2.07