Lineage for d1up5b1 (1up5 B:4-75)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768689Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 768749Protein Calmodulin [47516] (11 species)
  7. 768777Species Cow (Bos taurus) [TaxId:9913] [47518] (25 PDB entries)
    Uniprot P62157
  8. 768782Domain d1up5b1: 1up5 B:4-75 [119697]
    automatically matched to d1ak8__
    complexed with ca, m3l

Details for d1up5b1

PDB Entry: 1up5 (more details), 1.9 Å

PDB Description: chicken calmodulin
PDB Compounds: (B:) calmodulin

SCOP Domain Sequences for d1up5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1up5b1 a.39.1.5 (B:4-75) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}
lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
dfpefltmmark

SCOP Domain Coordinates for d1up5b1:

Click to download the PDB-style file with coordinates for d1up5b1.
(The format of our PDB-style files is described here.)

Timeline for d1up5b1: