SCOPe 2.05: Domain d1ul1x2: 1ul1 X:2-217

Lineage for d1ul1x2 (1ul1 X:2-217)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142118] (1 PDB entry)
   Uniprot P39748 2-217

8. Domain d1ul1x2: 1ul1 X:2-217 [119691]
   Other proteins in same PDB: d1ul1a1, d1ul1a2, d1ul1b1, d1ul1b2, d1ul1c1, d1ul1c2, d1ul1x1, d1ul1y1, d1ul1z1
   protein/DNA complex; complexed with mg

Details for d1ul1x2

PDB Entry: 1ul1, 2.9 Å

PDB Description: Crystal structure of the human FEN1-PCNA complex

PDB Compounds: (X:) Flap Endonuclease-1

SCOPe Domain Sequences for d1ul1x2:

Sequence, based on SEQRES records:

>d1ul1x2 c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]}
giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavrqggdvlqneegett
shlmgmfyrtirmmengikpvyvfdgkppqlksgelakrserraeaekqlqqaqaagaeq
evekftkrlvkvtkqhndeckhllslmgipyldapseaeascaalvkagkvyaaatedmd
cltfgspvlmrhltaseakklpiqefhlsrilqelg

Sequence, based on observed residues (ATOM records):

>d1ul1x2 c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]}
giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavttshlmgmfyrtirm
mengikpvyvfdgkppqlksgelakrlvkvtkqhndeckhllslmgipyldapseaeasc
aalvkagkvyaaatedmdcltfgspvlmrhltasekklpiqefhlsrilqelg

Timeline for d1ul1x2:

• d1ul1x2 first appeared in SCOP 1.73
  
• d1ul1x2 appears in SCOPe 2.04
  
• d1ul1x2 appears in SCOPe 2.06
  
• d1ul1x2 appears in the current release, SCOPe 2.08