Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (9 species) not a true protein |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (4 PDB entries) |
Domain d1uhkb_: 1uhk B: [119682] automated match to d1ej3a_ complexed with czn |
PDB Entry: 1uhk (more details), 1.6 Å
SCOPe Domain Sequences for d1uhkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhkb_ a.39.1.5 (B:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} anskltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrh kdaveaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdk dqngaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdp aceklyggavp
Timeline for d1uhkb_: