SCOPe 2.01: Domain d1uhkb_: 1uhk B:

Lineage for d1uhkb_ (1uhk B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (9 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (4 PDB entries)

8. Domain d1uhkb_: 1uhk B: [119682]
   automated match to d1ej3a_
   complexed with czn

Details for d1uhkb_

PDB Entry: 1uhk, 1.6 Å

PDB Description: Crystal structure of n-aequorin

PDB Compounds: (B:) Aequorin 2

SCOPe Domain Sequences for d1uhkb_:

Sequence; same for both SEQRES and ATOM records:

>d1uhkb_ a.39.1.5 (B:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
anskltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrh
kdaveaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdk
dqngaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdp
aceklyggavp

Timeline for d1uhkb_:

• d1uhkb_ first appeared in SCOP 1.73, called d1uhkb1
  
• d1uhkb_ was called d1uhkb1 in SCOP 1.75
  
• d1uhkb_ appears in SCOPe 2.02
  
• d1uhkb_ appears in the current release, SCOPe 2.08, called d1uhkb2