SCOP 1.75: Domain d1uhha1: 1uhh A:3-189

Lineage for d1uhha1 (1uhh A:3-189)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcium-regulated photoprotein [47512] (4 species)
   structurally most similar to sarcoplasmic calcium-binding protein

7. Species Jellyfish (Aequorea aequorea), aequorin [TaxId:168712] [47513] (5 PDB entries)

8. Domain d1uhha1: 1uhh A:3-189 [119675]
   automatically matched to d1ej3a_
   complexed with czp

Details for d1uhha1

PDB Entry: 1uhh, 1.8 Å

PDB Description: Crystal structure of cp-aequorin

PDB Compounds: (A:) Aequorin 2

SCOP Domain Sequences for d1uhha1:

Sequence; same for both SEQRES and ATOM records:

>d1uhha1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}
ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
lyggavp

Timeline for d1uhha1:

• d1uhha1 first appeared in SCOP 1.73
  
• d1uhha1 is called d1uhha_ in SCOPe 2.01
  
• d1uhha1 appears in the current release, SCOPe 2.08, called d1uhha2