Lineage for d1u9xa_ (1u9x A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926617Protein (Pro)cathepsin K [54028] (3 species)
  7. 2926618Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries)
    Uniprot P43235 116-329 ! Uniprot P43235 115-329
  8. 2926655Domain d1u9xa_: 1u9x A: [119654]
    automated match to d1tu6a_
    complexed with ihj

Details for d1u9xa_

PDB Entry: 1u9x (more details), 2.1 Å

PDB Description: crystal structure of the cysteine protease human cathepsin k in complex with the covalent inhibitor nvp-abj688
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d1u9xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9xa_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
rapdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvse
ndgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnek
alkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwi
iknswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d1u9xa_:

Click to download the PDB-style file with coordinates for d1u9xa_.
(The format of our PDB-style files is described here.)

Timeline for d1u9xa_: