Lineage for d1u8fo1 (1u8f O:3-151,O:316-335)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1578283Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1578524Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1578603Species Human (Homo sapiens), liver isoform [TaxId:9606] [141915] (2 PDB entries)
    Uniprot P04406 2-150,315-334
  8. 1578604Domain d1u8fo1: 1u8f O:3-151,O:316-335 [119626]
    Other proteins in same PDB: d1u8fo2, d1u8fp2, d1u8fq2, d1u8fr2
    automatically matched to 1ZNQ O:3-151,O:316-335
    complexed with nad

Details for d1u8fo1

PDB Entry: 1u8f (more details), 1.75 Å

PDB Description: Crystal Structure Of Human Placental Glyceraldehyde-3-Phosphate Dehydrogenase At 1.75 Resolution
PDB Compounds: (O:) Glyceraldehyde-3-phosphate dehydrogenase, liver

SCOPe Domain Sequences for d1u8fo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens), liver isoform [TaxId: 9606]}
kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
apsadapmfvmgvnhekydnslkiisnasXnefgysnrvvdlmahmaske

SCOPe Domain Coordinates for d1u8fo1:

Click to download the PDB-style file with coordinates for d1u8fo1.
(The format of our PDB-style files is described here.)

Timeline for d1u8fo1: