SCOP 1.73: Domain d1u7ra1: 1u7r A:1-153

Lineage for d1u7ra1 (1u7r A:1-153)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries)

8. Domain d1u7ra1: 1u7r A:1-153 [119621]
   automatically matched to d1ufpa_
   complexed with hem, imd

Details for d1u7ra1

PDB Entry: 1u7r, 1.15 Å

PDB Description: Crystal structure of Native Sperm Whale myoglobin from low ionic strength enviroment (Form2 )

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1u7ra1:

Sequence; same for both SEQRES and ATOM records:

>d1u7ra1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1u7ra1:

• d1u7ra1 is new in SCOP 1.73
  
• d1u7ra1 appears in SCOP 1.75
  
• d1u7ra1 appears in the current release, SCOPe 2.08, called d1u7ra_