| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.8: Ppx/GppA phosphatase [110630] (1 protein) Pfam PF02541 |
| Protein Exopolyphosphatase Ppx [110631] (2 species) |
| Species Escherichia coli [TaxId:562] [142466] (2 PDB entries) Uniprot P0AFL6 11-134! Uniprot P0AFL6 135-311 |
| Domain d1u6zb2: 1u6z B:12-135 [119612] Other proteins in same PDB: d1u6za1, d1u6zb1 automatically matched to 1U6Z A:12-135 complexed with so4 |
PDB Entry: 1u6z (more details), 1.9 Å
SCOP Domain Sequences for d1u6zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6zb2 c.55.1.8 (B:12-135) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]}
efaavdlgsnsfhmviarvvdgamqiigrlkqrvhladglgpdnmlseeamtrglnclsl
faerlqgfspasvcivgthtlrqalnatdflkraekvipypieiisgneearlifmgveh
tqpe
Timeline for d1u6zb2: