Lineage for d1u6za3 (1u6z A:136-312)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 836501Family c.55.1.8: Ppx/GppA phosphatase [110630] (1 protein)
    Pfam PF02541
  6. 836502Protein Exopolyphosphatase Ppx [110631] (2 species)
  7. 836514Species Escherichia coli [TaxId:562] [142466] (2 PDB entries)
    Uniprot P0AFL6 11-134! Uniprot P0AFL6 135-311
  8. 836516Domain d1u6za3: 1u6z A:136-312 [119610]
    Other proteins in same PDB: d1u6za1, d1u6zb1
    complexed with so4

Details for d1u6za3

PDB Entry: 1u6z (more details), 1.9 Å

PDB Description: Structure of an E. coli Exopolyphosphatase: Insight into the processive hydrolysis of polyphosphate and its regulation
PDB Compounds: (A:) exopolyphosphatase

SCOP Domain Sequences for d1u6za3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6za3 c.55.1.8 (A:136-312) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]}
kgrklvidigggstelvigenfepilvesrrmgcvsfaqlyfpggvinkenfqrarmaaa
qkletltwqfriqgwnvamgasgtikaahevlmemgekdgiitperleklvkevlrhrnf
aslslpglseerktvfvpglailcgvfdalairelrlsdgalregvlyemegrfrhq

SCOP Domain Coordinates for d1u6za3:

Click to download the PDB-style file with coordinates for d1u6za3.
(The format of our PDB-style files is described here.)

Timeline for d1u6za3: