Lineage for d1u6fa1 (1u6f A:1-139)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724565Protein RNA-binding protein UBP1 [143322] (1 species)
  7. 724566Species Trypanosoma cruzi [TaxId:5693] [143323] (1 PDB entry)
  8. 724567Domain d1u6fa1: 1u6f A:1-139 [119572]

Details for d1u6fa1

PDB Entry: 1u6f (more details)

PDB Description: NMR solution structure of TcUBP1, a single RBD-unit from Trypanosoma cruzi
PDB Compounds: (A:) RNA-binding protein UBP1

SCOP Domain Sequences for d1u6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}
msqiplvsqydpygqtaqlqqlqqqqqqhipptqmnpepdvlrnlmvnyipttvdevqlr
qlferygpiesvkivcdretrqsrgygfvkfqsgssaqqaiaglngfnilnkrlkvalaa
sghqrpgiagavgdgngyl

SCOP Domain Coordinates for d1u6fa1:

Click to download the PDB-style file with coordinates for d1u6fa1.
(The format of our PDB-style files is described here.)

Timeline for d1u6fa1: