SCOPe 2.07: Domain d1u6al2: 1u6a L:108-213

Lineage for d1u6al2 (1u6a L:108-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d1u6al2: 1u6a L:108-213 [119567]
   Other proteins in same PDB: d1u6ah1, d1u6ah2, d1u6al1
   automated match to d3hi1a2

Details for d1u6al2

PDB Entry: 1u6a, 2.81 Å

PDB Description: Crystal Structure of the Broadly Neutralizing Anti-HIV Fab F105

PDB Compounds: (L:) f105 light chain

SCOPe Domain Sequences for d1u6al2:

Sequence; same for both SEQRES and ATOM records:

>d1u6al2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d1u6al2:

• d1u6al2 first appeared in SCOP 1.73
  
• d1u6al2 appears in SCOPe 2.06
  
• d1u6al2 appears in the current release, SCOPe 2.08