SCOP 1.73: Domain d1u6ah1: 1u6a H:2-113

Lineage for d1u6ah1 (1u6a H:2-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (19 PDB entries)

8. Domain d1u6ah1: 1u6a H:2-113 [119564]
   Other proteins in same PDB: d1u6ah2, d1u6al1, d1u6al2
   automatically matched to d1aqkh1

Details for d1u6ah1

PDB Entry: 1u6a, 2.81 Å

PDB Description: Crystal Structure of the Broadly Neutralizing Anti-HIV Fab F105

PDB Compounds: (H:) f105 heavy chain

SCOP Domain Sequences for d1u6ah1:

Sequence; same for both SEQRES and ATOM records:

>d1u6ah1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
vqlqesgpglvkpsetlsltctvsggsisshywswirqspgkglqwigyiyysgstnysp
slksrvtisvetaknqfslkltsmtaadtavyycargpvpavfygdyrldpwgqgtlvtv
ss

Timeline for d1u6ah1:

• d1u6ah1 is new in SCOP 1.73
  
• d1u6ah1 appears in SCOP 1.75
  
• d1u6ah1 appears in the current release, SCOPe 2.08