Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) |
Domain d1u6ah1: 1u6a H:2-113 [119564] Other proteins in same PDB: d1u6ah2, d1u6al1, d1u6al2 automatically matched to d1aqkh1 |
PDB Entry: 1u6a (more details), 2.81 Å
SCOPe Domain Sequences for d1u6ah1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6ah1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} vqlqesgpglvkpsetlsltctvsggsisshywswirqspgkglqwigyiyysgstnysp slksrvtisvetaknqfslkltsmtaadtavyycargpvpavfygdyrldpwgqgtlvtv ss
Timeline for d1u6ah1: