SCOPe 2.04: Domain d1u5ca2: 1u5c A:165-330

Lineage for d1u5ca2 (1u5c A:165-330)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (8 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [254909] (5 PDB entries)

8. Domain d1u5ca2: 1u5c A:165-330 [119535]
   Other proteins in same PDB: d1u5ca1
   automated match to d1t2da2
   complexed with bik, nad

Details for d1u5ca2

PDB Entry: 1u5c, 2.65 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with 3,7-dihydroxynaphthalene-2-carboxylic acid and NAD+

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1u5ca2:

Sequence; same for both SEQRES and ATOM records:

>d1u5ca2 d.162.1.1 (A:165-330) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd
aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs
difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkalah

Timeline for d1u5ca2:

• d1u5ca2 first appeared in SCOP 1.73
  
• d1u5ca2 appears in SCOPe 2.03
  
• d1u5ca2 appears in SCOPe 2.05
  
• d1u5ca2 appears in the current release, SCOPe 2.08