Lineage for d1u5ca1 (1u5c A:18-163)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687902Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 687941Protein Lactate dehydrogenase [51859] (14 species)
  7. 688014Species Plasmodium berghei [TaxId:5821] [102165] (7 PDB entries)
  8. 688020Domain d1u5ca1: 1u5c A:18-163 [119534]
    Other proteins in same PDB: d1u5ca2
    automatically matched to d1oc4a1
    complexed with bik, nad

Details for d1u5ca1

PDB Entry: 1u5c (more details), 2.65 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with 3,7-dihydroxynaphthalene-2-carboxylic acid and NAD+
PDB Compounds: (A:) l-lactate dehydrogenase

SCOP Domain Sequences for d1u5ca1:

Sequence, based on SEQRES records: (download)

>d1u5ca1 c.2.1.5 (A:18-163) Lactate dehydrogenase {Plasmodium berghei [TaxId: 5821]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiigl

Sequence, based on observed residues (ATOM records): (download)

>d1u5ca1 c.2.1.5 (A:18-163) Lactate dehydrogenase {Plasmodium berghei [TaxId: 5821]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftrddllplnnkimieigghikkncpnafiivvtnpvdvm
vqllhqhsgvpknkiigl

SCOP Domain Coordinates for d1u5ca1:

Click to download the PDB-style file with coordinates for d1u5ca1.
(The format of our PDB-style files is described here.)

Timeline for d1u5ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u5ca2