Lineage for d1u3hh2 (1u3h H:4-93)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198561Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1198635Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88830] (5 PDB entries)
  8. 1198639Domain d1u3hh2: 1u3h H:4-93 [119517]
    Other proteins in same PDB: d1u3ha1, d1u3hb1, d1u3hc1, d1u3hc2, d1u3hd1, d1u3he_, d1u3hf_, d1u3hg1, d1u3hg2, d1u3hh1
    automatically matched to d1f3jb2

Details for d1u3hh2

PDB Entry: 1u3h (more details), 2.42 Å

PDB Description: Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A
PDB Compounds: (H:) H-2 class II histocompatibility antigen, A-U beta chain

SCOPe Domain Sequences for d1u3hh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3hh2 d.19.1.1 (H:4-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]}
erhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaeyynk
qylertraeldtvcrynyeetevptslrr

SCOPe Domain Coordinates for d1u3hh2:

Click to download the PDB-style file with coordinates for d1u3hh2.
(The format of our PDB-style files is described here.)

Timeline for d1u3hh2: