SCOP 1.73: Domain d1u3hg1: 1u3h G:82-181

Lineage for d1u3hg1 (1u3h G:82-181)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (20 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1u3hg1: 1u3h G:82-181 [119514]
   Other proteins in same PDB: d1u3hc2, d1u3hd1, d1u3hd2, d1u3hg2, d1u3hh1, d1u3hh2
   automatically matched to d1k2da1
   mutant

Details for d1u3hg1

PDB Entry: 1u3h, 2.42 Å

PDB Description: crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a

PDB Compounds: (G:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOP Domain Sequences for d1u3hg1:

Sequence; same for both SEQRES and ATOM records:

>d1u3hg1 b.1.1.2 (G:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

Timeline for d1u3hg1:

• d1u3hg1 is new in SCOP 1.73
  
• d1u3hg1 appears in SCOP 1.75
  
• d1u3hg1 appears in the current release, SCOPe 2.08