SCOP 1.73: Domain d1u39a1: 1u39 A:79-158

Lineage for d1u39a1 (1u39 A:79-158)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries)
   structure of the PTB domain is also known (scop_sp 50757)

8. Domain d1u39a1: 1u39 A:79-158 [119503]
   2nd PDZ domain

Details for d1u39a1

PDB Entry: 1u39

PDB Description: auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains

PDB Compounds: (A:) amyloid beta A4 precursor protein-binding, family A, member 1

SCOP Domain Sequences for d1u39a1:

Sequence; same for both SEQRES and ATOM records:

>d1u39a1 b.36.1.1 (A:79-158) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}
ppvttvlirrpdlryqlgfsvqngiicslmrggiaerggvrvghriieingqsvvatphe
kivhilsnavgeihmktmpa

Timeline for d1u39a1:

• d1u39a1 is new in SCOP 1.73
  
• d1u39a1 appears in SCOP 1.75
  
• d1u39a1 appears in the current release, SCOPe 2.08