Lineage for d1u35f1 (1u35 F:224-302)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909520Protein Histone H4 [47125] (5 species)
  7. 909521Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries)
  8. 909573Domain d1u35f1: 1u35 F:224-302 [119498]
    Other proteins in same PDB: d1u35a1, d1u35c1, d1u35d1, d1u35e1, d1u35g1, d1u35h1
    automatically matched to d1p3ob_
    protein/DNA complex

Details for d1u35f1

PDB Entry: 1u35 (more details), 3 Å

PDB Description: crystal structure of the nucleosome core particle containing the histone domain of macroh2a
PDB Compounds: (F:) Hist1h4i protein

SCOPe Domain Sequences for d1u35f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u35f1 a.22.1.1 (F:224-302) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1u35f1:

Click to download the PDB-style file with coordinates for d1u35f1.
(The format of our PDB-style files is described here.)

Timeline for d1u35f1: