Lineage for d1u2wc1 (1u2w C:17-114)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 761989Family a.4.5.5: ArsR-like transcriptional regulators [46801] (4 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 761990Protein Cadmium efflux system accessory protein CadC [140239] (1 species)
  7. 761991Species Staphylococcus aureus [TaxId:1280] [140240] (1 PDB entry)
    Uniprot P20047 12-119
  8. 761994Domain d1u2wc1: 1u2w C:17-114 [119489]
    automatically matched to 1U2W A:12-119
    complexed with zn; mutant

Details for d1u2wc1

PDB Entry: 1u2w (more details), 1.9 Å

PDB Description: Crystal Structure of the Staphylococcus aureus pI258 CadC
PDB Compounds: (C:) Cadmium efflux system accessory protein

SCOP Domain Sequences for d1u2wc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2wc1 a.4.5.5 (C:17-114) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]}
vnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvtianashh
lrtlykqgvvnfrkegklalyslgdehirqimmialah

SCOP Domain Coordinates for d1u2wc1:

Click to download the PDB-style file with coordinates for d1u2wc1.
(The format of our PDB-style files is described here.)

Timeline for d1u2wc1: