Lineage for d1u2wa1 (1u2w A:12-119)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635021Family a.4.5.5: ArsR-like transcriptional regulators [46801] (4 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 635022Protein Cadmium efflux system accessory protein CadC [140239] (1 species)
  7. 635023Species Staphylococcus aureus [TaxId:1280] [140240] (1 PDB entry)
  8. 635024Domain d1u2wa1: 1u2w A:12-119 [119487]
    complexed with zn; mutant

Details for d1u2wa1

PDB Entry: 1u2w (more details), 1.9 Å

PDB Description: crystal structure of the staphylococcus aureus pi258 cadc
PDB Compounds: (A:) Cadmium efflux system accessory protein

SCOP Domain Sequences for d1u2wa1:

Sequence, based on SEQRES records: (download)

>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]}
ydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvtia
nashhlrtlykqgvvnfrkegklalyslgdehirqimmialahkkevk

Sequence, based on observed residues (ATOM records): (download)

>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]}
ydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvtia
nashhlrtlykqgvvnfrlalyslgdehirqimmialahkkevk

SCOP Domain Coordinates for d1u2wa1:

Click to download the PDB-style file with coordinates for d1u2wa1.
(The format of our PDB-style files is described here.)

Timeline for d1u2wa1: