Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins) forms homohexameric ring structures |
Protein Pleiotropic translational regulator Hfq [74940] (3 species) |
Species Pseudomonas aeruginosa [TaxId:287] [141293] (12 PDB entries) Uniprot Q9HUM0 6-71 |
Domain d1u1tb_: 1u1t B: [119458] automated match to d1hk9d_ |
PDB Entry: 1u1t (more details), 1.9 Å
SCOPe Domain Sequences for d1u1tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1tb_ b.38.1.2 (B:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp srpvrl
Timeline for d1u1tb_: