SCOPe 2.01: Domain d1u1bb_: 1u1b B:

Lineage for d1u1bb_ (1u1b B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (69 PDB entries)

8. Domain d1u1bb_: 1u1b B: [119420]
   automated match to d1a2wa_
   complexed with pax

Details for d1u1bb_

PDB Entry: 1u1b, 2 Å

PDB Description: structure of bovine pancreatic ribonuclease a in complex with 3'- phosphothymidine (3'-5')-pyrophosphate adenosine 3'-phosphate

PDB Compounds: (B:) Ribonuclease, pancreatic

SCOPe Domain Sequences for d1u1bb_:

Sequence; same for both SEQRES and ATOM records:

>d1u1bb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1u1bb_:

• d1u1bb_ first appeared in SCOP 1.73, called d1u1bb1
  
• d1u1bb_ was called d1u1bb1 in SCOP 1.75
  
• d1u1bb_ appears in SCOPe 2.02
  
• d1u1bb_ appears in the current release, SCOPe 2.08