SCOP 1.73: Domain d1u0oa1: 1u0o A:1-133

Lineage for d1u0oa1 (1u0o A:1-133)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin alpha chain [88861] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88864] (4 PDB entries)

8. Domain d1u0oa1: 1u0o A:1-133 [119409]
   Other proteins in same PDB: d1u0ob1
   automatically matched to d1fvua_

Details for d1u0oa1

PDB Entry: 1u0o, 2.7 Å

PDB Description: The mouse von Willebrand Factor A1-botrocetin complex

PDB Compounds: (A:) Botrocetin

SCOP Domain Sequences for d1u0oa1:

Sequence; same for both SEQRES and ATOM records:

>d1u0oa1 d.169.1.1 (A:1-133) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

Timeline for d1u0oa1:

• d1u0oa1 is new in SCOP 1.73
  
• d1u0oa1 appears in SCOP 1.75
  
• d1u0oa1 appears in the current release, SCOPe 2.08, called d1u0oa_