SCOPe 2.07: Domain d1tzgm1: 1tzg M:1-106

Lineage for d1tzgm1 (1tzg M:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d1tzgm1: 1tzg M:1-106 [119402]
   Other proteins in same PDB: d1tzgh1, d1tzgh2, d1tzgi1, d1tzgi2, d1tzgl2, d1tzgm2
   automated match to d4fnll1
   complexed with gol

Details for d1tzgm1

PDB Entry: 1tzg, 2.2 Å

PDB Description: Crystal structure of HIV-1 neutralizing human Fab 4E10 in complex with a 13-residue peptide containing the 4E10 epitope on gp41

PDB Compounds: (M:) Fab 4E10

SCOPe Domain Sequences for d1tzgm1:

Sequence; same for both SEQRES and ATOM records:

>d1tzgm1 b.1.1.0 (M:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

Timeline for d1tzgm1:

• d1tzgm1 first appeared in SCOP 1.73
  
• d1tzgm1 appears in SCOPe 2.06
  
• d1tzgm1 appears in the current release, SCOPe 2.08