Lineage for d1tzgi1 (1tzg I:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510554Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 1510575Domain d1tzgi1: 1tzg I:1-113 [119398]
    Other proteins in same PDB: d1tzgh2, d1tzgi2, d1tzgl1, d1tzgl2, d1tzgm1, d1tzgm2
    automatically matched to d1hzhh1
    complexed with gol

Details for d1tzgi1

PDB Entry: 1tzg (more details), 2.2 Å

PDB Description: Crystal structure of HIV-1 neutralizing human Fab 4E10 in complex with a 13-residue peptide containing the 4E10 epitope on gp41
PDB Compounds: (I:) Fab 4E10

SCOPe Domain Sequences for d1tzgi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzgi1 b.1.1.1 (I:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
tlvtvss

SCOPe Domain Coordinates for d1tzgi1:

Click to download the PDB-style file with coordinates for d1tzgi1.
(The format of our PDB-style files is described here.)

Timeline for d1tzgi1: