![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (10 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins) |
![]() | Protein Plant pathogenesis-related protein PR10 [75543] (2 species) |
![]() | Species Jicama (Pachyrhizus erosus), SPE-16 [TaxId:109171] [143818] (2 PDB entries) Uniprot Q6T6J0 2-148 |
![]() | Domain d1txca1: 1txc A:1-147 [119384] automatically matched to 1TW0 A:1-147 complexed with 2an |
PDB Entry: 1txc (more details), 2.3 Å
SCOP Domain Sequences for d1txca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh tkgdaplsdavrddalakgagffkaie
Timeline for d1txca1: